HPA052583

antibody from Atlas Antibodies

Targeting: MME CALLA, CD10, NEP

Antibody data

Submit

Validation data

Product number: HPA052583 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA052583, RRID:AB_2681872
Product name: Anti-MME
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGE PLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQ LNSKYGKKVLINLFVGTDDK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MME protein structure - HPA052583 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human duodenum and cerebral cortex tissues using Anti-MME antibody. Corresponding MME RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, prostate and small intestine using Anti-MME antibody HPA052583 (A) shows similar protein distribution across tissues to independent antibody HPA056072 (B).
Antibody #2 product nr: HPA056072
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine using Anti-MME antibody HPA052583.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MME antibody HPA052583.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate using Anti-MME antibody HPA052583.
Sample type: HUMAN