HPA044848

antibody from Atlas Antibodies

Targeting: TNNC1 TNNC

Antibody data

Submit

Validation data

Product number: HPA044848 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA044848, RRID:AB_2679110
Product name: Anti-TNNC1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGC ISTKELGKVM
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TNNC1 protein structure - HPA044848 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human heart muscle and prostate tissues using Anti-TNNC1 antibody. Corresponding TNNC1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human heart muscle, liver, prostate and skeletal muscle using Anti-TNNC1 antibody HPA044848 (A) shows similar protein distribution across tissues to independent antibody HPA056897 (B).
Antibody #2 product nr: HPA056897
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle using Anti-TNNC1 antibody HPA044848.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-TNNC1 antibody HPA044848.
Sample type: HUMAN