R32181

antibody from NSJ Bioreagents

Targeting: EWSR1 EWS

Western blot (Supportive data in Antibodypedia)

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

R32181

Provider

NSJ Bioreagents

Product name

EWS Antibody / EWSR1

Antibody type

Polyclonal

Antigen

Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.

Description

Antigen affinity

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Vial size

100 µg

Concentration

Lyophilized; resuspend with 200 ul for 0.5 mg/ml

Storage

After reconstitution, the EWSR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Western blot

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

Western blot testing of 1) rat brain, 2) rat testis, 3) human HeLa, 4) SKOV and 5) SW620 lysate with EWSR1 antibody. Predicted molecular weight: ~69 kDa, but routinely observed at ~90 kDa.

Immunocytochemistry

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

ICC staining of FFPE human SMMC-7721 cells with EWSR1 antibody at 1ug/ml. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Immunohistochemistry

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE human breast cancer tissue with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE mouse testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE rat testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC staining of frozen human placental tissue with EWSR1 antibody at 1ug/ml.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC staining of frozen mouse intestinal tissue with EWSR1 antibody at 1ug/ml.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC staining of frozen rat intestinal tissue with EWSR1 antibody at 1ug/ml.