Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN630718 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
- Description
- Affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Submitted references Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms.
ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice.
The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice.
Kuroda E, Ishii KJ, Uematsu S, Ohata K, Coban C, Akira S, Aritake K, Urade Y, Morimoto Y
Immunity 2011 Apr 22;34(4):514-26
Immunity 2011 Apr 22;34(4):514-26
ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice.
Shi J, Zhang YW, Yang Y, Zhang L, Wei L
Journal of molecular and cellular cardiology 2010 Nov;49(5):819-28
Journal of molecular and cellular cardiology 2010 Nov;49(5):819-28
The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice.
Matsumoto T, Takahashi H, Shiva D, Kawanishi N, Kremenik MJ, Kato Y, Yano H
Physiology & behavior 2008 Mar 18;93(4-5):835-41
Physiology & behavior 2008 Mar 18;93(4-5):835-41
No comments: Submit comment
No validations: Submit validation data