AMAb91153

antibody from Atlas Antibodies

Targeting: GAPDH GAPD

Western blot (Enhanced validation)

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

AMAb91153

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb91153, RRID:AB_2665822

Product name

Anti-GAPDH

Antibody type

Monoclonal

Reactivity

Human

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAE
YVVESTGVFTTMEKAGAHLQGGAKRVIIS


Isotype

IgG

Antibody clone number

CL3266

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Genetic validation

Main image

Experimental details

Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GAPDH antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431 and human cell line HepG2.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-GAPDH monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.

Immunocytochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of A549 cells using the Anti-GAPDH monoclonal antibody, showing specific staining in the nucleoplasm and cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).

Sample type

HUMAN

Immunohistochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human kidney shows cytoplasmic and nuclear immunoreactivity in renal tubules and glomerular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human fallopian tube shows cytoplasmic and nuclear positivity in the epithelial and connective tissue cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human liver shows cytoplasmic and nuclear immunoreactivity in hepatocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows nuclear and cytoplasmic immunoreactivity in both endocrine and exocrine cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human duodenum shows nuclear and cytoplasmic positivity in glandular and in connective tissue cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic and nuclear immunoreactivity in muscle fibers.