Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000525-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000525-M02, RRID:AB_1671465
- Product name
- ATP6V1B1 monoclonal antibody (M02), clone 3G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ATP6V1B1.
- Antigen sequence
MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYIT
HPRVTYRTVCSVNGPLVVLDRVKFAQYAEIVHFTL
PDGTQ- Isotype
- IgG
- Antibody clone number
- 3G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ATP6V1B1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol