Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502195 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Brain-Derived Neurotrophic Factor (BDNF) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETK CNPMGYTKEG- Vial size
- 50 µg
Submitted references Epigenetic inheritance of a cocaine-resistance phenotype.
Cocaine alters BDNF expression and neuronal migration in the embryonic mouse forebrain.
Dose-dependent effect of the Val66Met polymorphism of the brain-derived neurotrophic factor gene on memory-related hippocampal activity.
Vassoler FM, White SL, Schmidt HD, Sadri-Vakili G, Pierce RC
Nature neuroscience 2013 Jan;16(1):42-7
Nature neuroscience 2013 Jan;16(1):42-7
Cocaine alters BDNF expression and neuronal migration in the embryonic mouse forebrain.
McCarthy DM, Zhang X, Darnell SB, Sangrey GR, Yanagawa Y, Sadri-Vakili G, Bhide PG
The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 Sep 21;31(38):13400-11
The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 Sep 21;31(38):13400-11
Dose-dependent effect of the Val66Met polymorphism of the brain-derived neurotrophic factor gene on memory-related hippocampal activity.
Hashimoto R, Moriguchi Y, Yamashita F, Mori T, Nemoto K, Okada T, Hori H, Noguchi H, Kunugi H, Ohnishi T
Neuroscience research 2008 Aug;61(4):360-7
Neuroscience research 2008 Aug;61(4):360-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry