HPA019025

antibody from Atlas Antibodies

Targeting: SERPINB5 maspin, PI5

Western blot (Supportive data in Antibodypedia)

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

HPA019025

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA019025, RRID:AB_1856726

Product name

Anti-SERPINB5

Antibody type

Polyclonal

Reactivity

Human, Rat

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICL
STSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGF
QTVTSDVNKLSSFYSLKLIKRLYVD


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Genetic validation

Main image

Experimental details

Western blot analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SERPINB5 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-SERPINB5 antibody. Corresponding SERPINB5 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Orthogonal method

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.

Sample type

HUMAN

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA019025 antibody. Corresponding SERPINB5 RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Independent antibody validation

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex, liver, skin and testis using Anti-SERPINB5 antibody HPA019025 (A) shows similar protein distribution across tissues to independent antibody HPA019132 (B).

Antibody #2 product nr

HPA020136, HPA019132

Antibody provider

Atlas Antibodies

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cervix, uterine shows high expression.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human upper gastrointestinal shows weak to moderate cytoplasmic/membranous positivity in glandular cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human skin shows strong positivity in squamous epithelial cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human liver using Anti-SERPINB5 antibody HPA019025.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human testis using Anti-SERPINB5 antibody HPA019025.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex using Anti-SERPINB5 antibody HPA019025.

Sample type

HUMAN