Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006461-M07 - Provider product page
- Provider
- Abnova Corporation
- Product name
- SHB monoclonal antibody (M07), clone 4C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SHB.
- Antigen sequence
GKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQ
LYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDD
RPADEYDQPWEWNRVTSPALAAQFNGNEK- Isotype
- IgG
- Antibody clone number
- 4C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SHB monoclonal antibody (M07), clone 4C11. Western Blot analysis of SHB expression in rat brain.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SHB monoclonal antibody (M07), clone 4C11. Western Blot analysis of SHB expression in 293.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SHB is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol