H00027032-M01
antibody from Abnova Corporation
Targeting: ATP2C1
ATP2C1A, BCPM, KIAA1347, PMR1, SPCA1
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027032-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027032-M01, RRID:AB_464127
- Product name
- ATP2C1 monoclonal antibody (M01), clone 2G1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ATP2C1.
- Antigen sequence
VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLAR
DLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSL
TGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLV
RCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPL
QKSMDLLGKQL- Isotype
- IgG
- Antibody clone number
- 2G1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cofilin recruits F-actin to SPCA1 and promotes Ca2+-mediated secretory cargo sorting.
Golgi calcium pump secretory pathway calcium ATPase 1 (SPCA1) is a key regulator of insulin-like growth factor receptor (IGF1R) processing in the basal-like breast cancer cell line MDA-MB-231.
Kienzle C, Basnet N, Crevenna AH, Beck G, Habermann B, Mizuno N, von Blume J
The Journal of cell biology 2014 Sep 1;206(5):635-54
The Journal of cell biology 2014 Sep 1;206(5):635-54
Golgi calcium pump secretory pathway calcium ATPase 1 (SPCA1) is a key regulator of insulin-like growth factor receptor (IGF1R) processing in the basal-like breast cancer cell line MDA-MB-231.
Grice DM, Vetter I, Faddy HM, Kenny PA, Roberts-Thomson SJ, Monteith GR
The Journal of biological chemistry 2010 Nov 26;285(48):37458-66
The Journal of biological chemistry 2010 Nov 26;285(48):37458-66
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ATP2C1 monoclonal antibody (M01), clone 2G1 Western Blot analysis of ATP2C1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ATP2C1 expression in transfected 293T cell line by ATP2C1 monoclonal antibody (M01), clone 2G1.Lane 1: ATP2C1 transfected lysate(100.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ATP2C1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ATP2C1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of ATP2C1 transfected lysate using anti-ATP2C1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ATP2C1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol