Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002380 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002380, RRID:AB_1844432
- Product name
- Anti-ABCC1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLAR
DGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEA
KQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHH
NSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVY
WD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Vascular and extravascular distribution of the ATP-binding cassette transporters ABCB1 and ABCC1 in aged human brain and pituitary
In vitro drug response and efflux transporters associated with drug resistance in pediatric high grade glioma and diffuse intrinsic pontine glioma.
Bernstein H, Hölzl G, Dobrowolny H, Hildebrandt J, Trübner K, Krohn M, Bogerts B, Pahnke J
Mechanisms of Ageing and Development 2014 November;141-142
Mechanisms of Ageing and Development 2014 November;141-142
In vitro drug response and efflux transporters associated with drug resistance in pediatric high grade glioma and diffuse intrinsic pontine glioma.
Veringa SJ, Biesmans D, van Vuurden DG, Jansen MH, Wedekind LE, Horsman I, Wesseling P, Vandertop WP, Noske DP, Kaspers GJ, Hulleman E
PloS one 2013;8(4):e61512
PloS one 2013;8(4):e61512
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in a subset of cells in glomeruli.
- Sample type
- HUMAN