Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310240 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Thyroid Stimulating Hormone Receptor (TSHR) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLG
RKSLS FETQKAPRSS- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Semiquantitative immunohistochemical marker staining and localization in canine thyroid carcinoma and normal thyroid gland.
A hydrophobic cluster in the center of the third extracellular loop is important for thyrotropin receptor signaling.
Pessina P, Castillo V, Sartore I, Borrego J, Meikle A
Veterinary and comparative oncology 2014 Aug 1;
Veterinary and comparative oncology 2014 Aug 1;
A hydrophobic cluster in the center of the third extracellular loop is important for thyrotropin receptor signaling.
Claus M, Jaeschke H, Kleinau G, Neumann S, Krause G, Paschke R
Endocrinology 2005 Dec;146(12):5197-203
Endocrinology 2005 Dec;146(12):5197-203
No comments: Submit comment
No validations: Submit validation data