HPA037824

antibody from Atlas Antibodies

Targeting: ARMC3 CT81, FLJ32827

Antibody data

Submit

Validation data

Product number: HPA037824 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA037824, RRID:AB_10671634
Product name: Anti-ARMC3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NAAAEADGIDPLINLLSSKRDGAIANAATVLTNMA MQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAAL AVTATACDVEARTELRNSGGLEPLV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ARMC3 protein structure - HPA037824 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-ARMC3 antibody. Corresponding ARMC3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human fallopian tube, kidney, liver and testis using Anti-ARMC3 antibody HPA037824 (A) shows similar protein distribution across tissues to independent antibody HPA037823 (B).
Antibody #2 product nr: HPA037823
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows strong positivity in cilia.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ARMC3 antibody HPA037824.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ARMC3 antibody HPA037824.
Sample type: HUMAN