HPA063425

antibody from Atlas Antibodies

Targeting: PLAC1 CT92, OOSP2B, OOSP2L

Antibody data

Submit

Validation data

Product number: HPA063425 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA063425, RRID:AB_2685012
Product name: Anti-PLAC1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELH LGLGCPPNHVQPHAYQFTYRVTECGIRA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PLAC1 protein structure - HPA063425 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and prostate tissues using HPA063425 antibody. Corresponding PLAC1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate positivity in secretion.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected.
Sample type: HUMAN