Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503773 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Retinal Degeneration 3 (RD3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RD3 antibody: synthetic peptide directed towards the N terminal of human RD3
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRS
TYDLS PIERLQLEDV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Premature truncation of a novel protein, RD3, exhibiting subnuclear localization is associated with retinal degeneration.
Friedman JS, Chang B, Kannabiran C, Chakarova C, Singh HP, Jalali S, Hawes NL, Branham K, Othman M, Filippova E, Thompson DA, Webster AR, Andréasson S, Jacobson SG, Bhattacharya SS, Heckenlively JR, Swaroop A
American journal of human genetics 2006 Dec;79(6):1059-70
American journal of human genetics 2006 Dec;79(6):1059-70
No comments: Submit comment
No validations: Submit validation data