Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- NBP1-94083 - Provider product page
- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#NBP1-94083, RRID:AB_11017842
- Product name
- Rabbit Polyclonal C20orf166 Antibody
- Antibody type
- Polyclonal
- Antigen
- This antibody was developed against Recombinant Protein corresponding to amino acids:RGQLQVSPEMSITHKEKENAHLKEILLFVNAEAFSQPQPHSAPVCEGQQLTGKFSTSVLTRAGGDASPCSWERLLCYGWS
- Reactivity
- Human
- Host
- Rabbit
- Vial size
- 0.1 ml
- Storage
- Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Immunohistochemistry-Paraffin: C20orf166 Antibody [NBP1-94083] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.