H00000534-M02
antibody from Abnova Corporation
Targeting: ATP6V1G2
ATP6G, ATP6G2, Em:AC004181.3, NG38, Vma10
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000534-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000534-M02, RRID:AB_581616
- Product name
- ATP6V1G2 monoclonal antibody (M02), clone 2E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ATP6V1G2.
- Antigen sequence
QMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQ
ATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQV
HPNYRISA- Isotype
- IgG
- Antibody clone number
- 2E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ATP6V1G2 monoclonal antibody (M02), clone 2E11 Western Blot analysis of ATP6V1G2 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ATP6V1G2 expression in transfected 293T cell line by ATP6V1G2 monoclonal antibody (M02), clone 2E11.Lane 1: ATP6V1G2 transfected lysate(13.6 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ATP6V1G2 monoclonal antibody (M02), clone 2E11. Western Blot analysis of ATP6V1G2 expression in Raw 264.7 ( Cat # L024V1 ).