HPA062907

antibody from Atlas Antibodies

Targeting: TMEM72 bA285G1.3, C10orf127, KSP37

Antibody data

Submit

Validation data

Product number: HPA062907 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA062907, RRID:AB_2684900
Product name: Anti-TMEM72
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVP SLAEGLDD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TMEM72 protein structure - HPA062907 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-TMEM72 antibody. Corresponding TMEM72 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and lymph node using Anti-TMEM72 antibody HPA062907 (A) shows similar protein distribution across tissues to independent antibody HPA039894 (B).
Antibody #2 product nr: HPA039894
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-TMEM72 antibody HPA062907.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-TMEM72 antibody HPA062907.
Sample type: HUMAN