HPA058399

antibody from Atlas Antibodies

Targeting: SNTN FLJ44379, S100AL

Antibody data

Submit

Validation data

Product number: HPA058399 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA058399, RRID:AB_2683705
Product name: Anti-SNTN
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KAIAKDLLQTQFRNFAEGQETKPKYREILSELDEH TENKLDFEDFMILLLSITVMSDLLQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SNTN protein structure - HPA058399 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-SNTN antibody. Corresponding SNTN RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, fallopian tube, prostate and testis using Anti-SNTN antibody HPA058399 (A) shows similar protein distribution across tissues to independent antibody HPA043322 (B).
Antibody #2 product nr: HPA043322
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SNTN antibody HPA058399.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SNTN antibody HPA058399.
Sample type: HUMAN