ABIN635602

antibody from antibodies-online

Targeting: MTUS1 ATBP, ATIP1, ATIP3, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN635602 - Provider product page
Provider: antibodies-online
Product name: anti-Microtubule Associated Tumor Suppressor 1 (MTUS1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: MTUS1 antibody was raised using the middle region of MTUS1 corresponding to a region with amino acids KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

MTUS1 protein structure - ABIN635602 shown in red.