Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00063922-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00063922-M01, RRID:AB_464023
- Product name
- CHTF18 monoclonal antibody (M01), clone 1F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CHTF18.
- Antigen sequence
GVHRPAPRNHEQRLEHIMRRAAREEQPEKDFFGRV
VVRSTAVPSAGDTAPEQDSVERRMGTAVGRSEVWF
RFNEGVSNAVRRSLYIRDLL- Isotype
- IgG
- Antibody clone number
- 1F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Two different replication factor C proteins, Ctf18 and RFC1, separately control PCNA-CRL4Cdt2-mediated Cdt1 proteolysis during S phase and following UV irradiation.
Stable interaction between the human proliferating cell nuclear antigen loader complex Ctf18-replication factor C (RFC) and DNA polymerase {epsilon} is mediated by the cohesion-specific subunits, Ctf18, Dcc1, and Ctf8.
Shiomi Y, Hayashi A, Ishii T, Shinmyozu K, Nakayama J, Sugasawa K, Nishitani H
Molecular and cellular biology 2012 Jun;32(12):2279-88
Molecular and cellular biology 2012 Jun;32(12):2279-88
Stable interaction between the human proliferating cell nuclear antigen loader complex Ctf18-replication factor C (RFC) and DNA polymerase {epsilon} is mediated by the cohesion-specific subunits, Ctf18, Dcc1, and Ctf8.
Murakami T, Takano R, Takeo S, Taniguchi R, Ogawa K, Ohashi E, Tsurimoto T
The Journal of biological chemistry 2010 Nov 5;285(45):34608-15
The Journal of biological chemistry 2010 Nov 5;285(45):34608-15
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CHTF18 monoclonal antibody (M01), clone 1F5 Western Blot analysis of CHTF18 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CHTF18 expression in transfected 293T cell line by CHTF18 monoclonal antibody (M01), clone 1F5.Lane 1: CHTF18 transfected lysate(107 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CHTF18 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
