HPA038218

antibody from Atlas Antibodies

Targeting: VPS37B FLJ12750

Antibody data

Submit

Validation data

Product number: HPA038218 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038218, RRID:AB_2675898
Product name: Anti-VPS37B
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQ NVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLT QKYQELQVLFEAYQIKKTKLDRQSSSASL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

VPS37B protein structure - HPA038218 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-VPS37B antibody HPA038218 (A) shows similar protein distribution across tissues to independent antibody HPA038217 (B).
Antibody #2 product nr: HPA038217
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-VPS37B antibody HPA038218.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-VPS37B antibody HPA038218.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-VPS37B antibody HPA038218.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-VPS37B antibody HPA038218.
Sample type: HUMAN