HPA045046

antibody from Atlas Antibodies

Targeting: SMIM24 C19orf77, HSPC323

Antibody data

Submit

Validation data

Product number: HPA045046 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA045046, RRID:AB_10964444
Product name: Anti-SMIM24
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NRLWCSKARAEDEEETTFRMESNLYQDQSEDKREK KEAKEKEEKRKKE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SMIM24 protein structure - HPA045046 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human epididymis and endometrium tissues using Anti-SMIM24 antibody. Corresponding SMIM24 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, epididymis, kidney and testis using Anti-SMIM24 antibody HPA045046 (A) shows similar protein distribution across tissues to independent antibody HPA056027 (B).
Antibody #2 product nr: HPA056027
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong luminal membranous and extracellular positivity in cells of tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SMIM24 antibody HPA045046.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-SMIM24 antibody HPA045046.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SMIM24 antibody HPA045046.
Sample type: HUMAN