Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183296 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TGIF2LY antibody: synthetic peptide directed towards the middle region of human TGIF2LY
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
NWFINARRRILPDMLQQRRNDPIIGHKTGKDAHAT
HLQST EASVPAKSGP- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
Skaletsky H, Kuroda-Kawaguchi T, Minx PJ, Cordum HS, Hillier L, Brown LG, Repping S, Pyntikova T, Ali J, Bieri T, Chinwalla A, Delehaunty A, Delehaunty K, Du H, Fewell G, Fulton L, Fulton R, Graves T, Hou SF, Latrielle P, Leonard S, Mardis E, Maupin R, McPherson J, Miner T, Nash W, Nguyen C, Ozersky P, Pepin K, Rock S, Rohlfing T, Scott K, Schultz B, Strong C, Tin-Wollam A, Yang SP, Waterston RH, Wilson RK, Rozen S, Page DC
Nature 2003 Jun 19;423(6942):825-37
Nature 2003 Jun 19;423(6942):825-37
No comments: Submit comment
No validations: Submit validation data