Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031065 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031065, RRID:AB_10610146
- Product name
- Anti-NPR3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHW
SRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTS
IYSFDETKDLDLEDIVRNIQASERVVIMCASSDTI
RSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSW- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Molecular subgroups of medulloblastoma: the current consensus.
Taylor MD, Northcott PA, Korshunov A, Remke M, Cho YJ, Clifford SC, Eberhart CG, Parsons DW, Rutkowski S, Gajjar A, Ellison DW, Lichter P, Gilbertson RJ, Pomeroy SL, Kool M, Pfister SM
Acta neuropathologica 2012 Apr;123(4):465-72
Acta neuropathologica 2012 Apr;123(4):465-72
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell line HeLa and human cell line CACO-2.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and cerebral cortex tissues using HPA031065 antibody. Corresponding NPR3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in leydig cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in cells in glomeruli.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate to strong membranous positivity in smooth muscle cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows moderate to strong membranous positivity in smooth muscle cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
- Sample type
- HUMAN
