HPA050341

antibody from Atlas Antibodies

Targeting: ELSPBP1 E12, EDDM12, HE12

Antibody data

Submit

Validation data

Product number: HPA050341 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA050341, RRID:AB_2681097
Product name: Anti-ELSPBP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TTENMDKDGKWSFCADTRISALVPGFPCHFPFNYK NKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ELSPBP1 protein structure - HPA050341 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human epididymis and prostate tissues using HPA050341 antibody. Corresponding ELSPBP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, epididymis, prostate and testis using Anti-ELSPBP1 antibody HPA050341 (A) shows similar protein distribution across tissues to independent antibody HPA044256 (B).
Antibody #2 product nr: HPA044256
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN