H00006218-M01
antibody from Abnova Corporation
Targeting: RPS17
MGC72007, RPS17L, RPS17L1, RPS17L2, S17
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006218-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006218-M01, RRID:AB_606959
- Product name
- RPS17 monoclonal antibody (M01), clone 2C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RPS17.
- Antigen sequence
EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGIS
IKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEM
LKLLDFGSLSNLQVTQPTVGMNFKTPRGPV- Isotype
- IgG
- Antibody clone number
- 2C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RPS17 monoclonal antibody (M01), clone 2C7 Western Blot analysis of RPS17 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RPS17 monoclonal antibody (M01), clone 2C7. Western Blot analysis of RPS17 expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RPS17 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RPS17 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol