Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183802 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 253 (ZNF253) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF253 antibody: synthetic peptide directed towards the C terminal of human ZNF253
- Description
- Protein A purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
LTTHKRIHTGEKPYKCEECGKAFNWSSDLNKHKKI
HIERK PYIVKNVTDL- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB.
Han ZG, Zhang QH, Ye M, Kan LX, Gu BW, He KL, Shi SL, Zhou J, Fu G, Mao M, Chen SJ, Yu L, Chen Z
The Journal of biological chemistry 1999 Dec 10;274(50):35741-8
The Journal of biological chemistry 1999 Dec 10;274(50):35741-8
No comments: Submit comment
No validations: Submit validation data