ABIN1449891

antibody from antibodies-online

Targeting: ZNF93 FLJ12488, HPF34, TF34, ZNF505

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

ABIN1449891

Provider

antibodies-online

Product name

anti-Zinc Finger Protein 93 (ZNF93) antibody

Antibody type

Polyclonal

Antigen

A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC

Description

Purified using peptide immunoaffinity column

Reactivity

Human, Mouse, Rat, Bovine, Xenopus, Zebrafish

Host

Rabbit

Vial size

50 μg

Concentration

1.0 mg/mL after reconstitution

Storage

Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.

Handling

Avoid repeated freezing and thawing.

References

Submitted references

The DNA sequence and biology of human chromosome 19.

Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM
Nature 2004 Apr 1;428(6982):529-35

Western blot

Supportive validation

Submitted by

antibodies-online (provider)

Main image

Experimental details

Human MCF7; Host:Rabbit. Target Name:ZNF93. Sample Tissue:Human MCF7. Antibody Dilution: 1.0ug/ml. ZNF93 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.; ZNF93 antibody - N-terminal region (AP45232PU-N) in Human MCF7 cells using Western Blot