HPA016438

antibody from Atlas Antibodies

Targeting: ZNF185 SCELL

Antibody data

Submit

Validation data

Product number: HPA016438 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA016438, RRID:AB_1859109
Product name: Anti-ZNF185
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HSYVLSAAKKSTGSPTQETQAPFIAKRVEVVEEDG PSEKSQDPPALARSTPGSNSSRGEEIVRLQILTPR AGLRLVAPDVEGMRSSPGNKDKEAPCSRELQRDLA GEEAFRAPNTDAARSSAQLSDGNVGSGATGSRPEG LAAVDIGSERGSSSATSVSAAPADRKSNSTAAQED AKAD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ZNF185 protein structure - HPA016438 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human epididymis and liver tissues using Anti-ZNF185 antibody. Corresponding ZNF185 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human epididymis, liver, lymph node and testis using Anti-ZNF185 antibody HPA016438 (A) shows similar protein distribution across tissues to independent antibody HPA000400 (B).
Antibody #2 product nr: HPA000400
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ZNF185 antibody HPA016438.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ZNF185 antibody HPA016438.
Sample type: HUMAN