HPA039063

antibody from Atlas Antibodies

Targeting: MAP1A MAP1L

Antibody data

Submit

Validation data

Product number: HPA039063 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA039063, RRID:AB_2676327
Product name: Anti-MAP1A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VQEWQETSPTREEPAGEQKELAPAWEDTSPEQDNR YWRGREDVALEQDTYWRELSCERKVWFPHELDGQG ARPHYTEERESTFLDEGPDDEQEVPLREHATRSPW ASDFKDFQESSPQK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MAP1A protein structure - HPA039063 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MAP1A antibody. Corresponding MAP1A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebellum, cerebral cortex, lymph node and pancreas using Anti-MAP1A antibody HPA039063 (A) shows similar protein distribution across tissues to independent antibody HPA039064 (B).
Antibody #2 product nr: HPA039064
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MAP1A antibody HPA039063.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum using Anti-MAP1A antibody HPA039063.
Sample type: HUMAN