HPA042710

antibody from Atlas Antibodies

Targeting: WFDC8 C20orf170, dJ461P17.1, WAP8

Antibody data

Submit

Validation data

Product number: HPA042710 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042710, RRID:AB_2732501
Product name: Anti-WFDC8
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KHKPGLCPKERLTCTTELPDSCNTDFDCKEYQKCC FFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFD FKNYRCTPFKYRGCEGNA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

WFDC8 protein structure - HPA042710 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human epididymis and colon tissues using Anti-WFDC8 antibody. Corresponding WFDC8 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, epididymis and liver using Anti-WFDC8 antibody HPA042710 (A) shows similar protein distribution across tissues to independent antibody HPA071119 (B).
Antibody #2 product nr: HPA071119
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-WFDC8 antibody HPA042710.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-WFDC8 antibody HPA042710.
Sample type: HUMAN