Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB27988 - Provider product page
- Provider
- Abnova Corporation
- Product name
- KIAA1210 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant KIAA1210
- Antigen sequence
SQPETTTPQGLLSDKDDMGRRNAGIDFGSRKASAA
QPIPENMDNSMVSDPQPYHEDAASGAEKTEARASL
SLMVESLSTTQEEAILSVAAEAQVFMNPSHIQLED
QEAFSFDLQKAQSKMESAQDVQTICKEKPSGNVHQ
TFTASV- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4 Lane 2: EFO-21 Lane 3: A-431 Lane 4: Liver Lane 5: Tonsil with KIAA1210 polyclonal antibody ( Cat # PAB27988 ) at 1:250 - 1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis with KIAA1210 polyclonal antibody ( Cat # PAB27988 ) shows strong cytoplasmic and membranous positivity in cells of seminiferus ducts at 1:50 - 1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)