Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003217-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003217-M01, RRID:AB_565852
- Product name
- HOXB7 monoclonal antibody (M01), clone 4F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HOXB7.
- Antigen sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHC
APFEQNLSGVCPGDSAKAAGAKEQRDSDLAA- Isotype
- IgG
- Antibody clone number
- 4F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Evidence for a functional role of epigenetically regulated midcluster HOXB genes in the development of Barrett esophagus.
Oncogenic HoxB7 requires TALE cofactors and is inactivated by a dominant-negative Pbx1 mutant in a cell-specific manner.
di Pietro M, Lao-Sirieix P, Boyle S, Cassidy A, Castillo D, Saadi A, Eskeland R, Fitzgerald RC
Proceedings of the National Academy of Sciences of the United States of America 2012 Jun 5;109(23):9077-82
Proceedings of the National Academy of Sciences of the United States of America 2012 Jun 5;109(23):9077-82
Oncogenic HoxB7 requires TALE cofactors and is inactivated by a dominant-negative Pbx1 mutant in a cell-specific manner.
Fernandez LC, Errico MC, Bottero L, Penkov D, Resnati M, Blasi F, Caré A
Cancer letters 2008 Aug 8;266(2):144-55
Cancer letters 2008 Aug 8;266(2):144-55
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HOXB7 expression in transfected 293T cell line by HOXB7 monoclonal antibody (M01), clone 4F9.Lane 1: HOXB7 transfected lysate(23.97 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HOXB7 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol