Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001604-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001604-M01, RRID:AB_489756
- Product name
- DAF monoclonal antibody (M01), clone 1G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DAF.
- Antigen sequence
DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESF
VKIPGEKDSVICLRGSQWSDIEEFCNRSCEVPTRL
NSASLKQPYITQNYFPVGTVVEYECRPGYR- Isotype
- IgG
- Antibody clone number
- 1G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel form of Total Internal Reflection Fluorescence Microscopy (LG-TIRFM) reveals different and independent lipid raft domains in living cells.
Asanov A, Zepeda A, Vaca L
Biochimica et biophysica acta 2010 Feb;1801(2):147-55
Biochimica et biophysica acta 2010 Feb;1801(2):147-55
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- DAF monoclonal antibody (M01), clone 1G3 Western Blot analysis of DAF expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CD55 expression in transfected 293T cell line by DAF monoclonal antibody (M01), clone 1G3.Lane 1: CD55 transfected lysate(41.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DAF is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between LCK and CD55. HeLa cells were stained with anti-LCK rabbit purified polyclonal 1:1200 and anti-CD55 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
