HPA001830
antibody from Atlas Antibodies
Targeting: SNAP25
bA416N4.2, dJ1068F16.2, RIC-4, RIC4, SEC9, SNAP, SNAP-25
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001830 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001830, RRID:AB_1080039
- Product name
- Anti-SNAP25
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISG
GFIRRVTNDARENEMDENLEQVSGIIGNLRHMALD
MGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATK
MLGSG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
Immunohistochemical approach to the pathogenesis of clinical cases of bovine Herpesvirus type 5 infections.
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Lindskog C, Korsgren O, Pontén F, Eriksson J, Johansson L, Danielsson A
Journal of Proteomics 2012 May;75(9):2611-2620
Journal of Proteomics 2012 May;75(9):2611-2620
Immunohistochemical approach to the pathogenesis of clinical cases of bovine Herpesvirus type 5 infections.
Cardoso TC, Ferrari HF, Garcia AF, Bregano LC, Andrade AL, Nogueira AH
Diagnostic pathology 2010 Sep 10;5:57
Diagnostic pathology 2010 Sep 10;5:57
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
Enhanced validation
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines U2OS and MCF-7 using Anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and SNAP25 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418912).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN