Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007297-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007297-M01, RRID:AB_489971
- Product name
- TYK2 monoclonal antibody (M01), clone 6G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TYK2.
- Antigen sequence
PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAG
PPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGR
NPQASLFGKKAKAHKAFGQPADRPREPLWA- Isotype
- IgG
- Antibody clone number
- 6G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TYK2 monoclonal antibody (M01), clone 6G12 Western Blot analysis of TYK2 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TYK2 expression in transfected 293T cell line by TYK2 monoclonal antibody (M01), clone 6G12.Lane 1: TYK2 transfected lysate(133.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TYK2 is 1 ng/ml as a capture antibody.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TYK2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of TYK2 transfected lysate using anti-TYK2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TYK2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
