PAB20149
antibody from Abnova Corporation
Targeting: LAMTOR1
C11orf59, FLJ20625, p18, p27RF-Rho, Pdro, Ragulator1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20149 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20149, RRID:AB_10962223
- Product name
- C11orf59 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant C11orf59.
- Antigen sequence
NEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSL
PSARTDEQALLSSILAKTASNIIDVSAADSQGMEQ
HEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTS
QPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRV
DAKEELVV- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with C11orf59 polyclonal antibody (Cat # PAB20149) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with C11orf59 polyclonal antibody (Cat # PAB20149) at 1-4 ug/mL dilution shows positivity in plasma membrane, golgi apparatus.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum with C11orf59 polyclonal antibody (Cat # PAB20149) shows strong cytoplasmic positivity, with a granular pattern, in glandular cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)