HPA004114

antibody from Atlas Antibodies

Targeting: MRC1 bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1

Antibody data

Submit

Validation data

Product number: HPA004114 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA004114, RRID:AB_1846270
Product name: Anti-MRC1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSE SQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQ KWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGS GLWSRWKIYG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MRC1 protein structure - HPA004114 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and cerebral cortex tissues using HPA004114 antibody. Corresponding MRC1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, lung and placenta using Anti-MRC1 antibody HPA004114 (A) shows similar protein distribution across tissues to independent antibody HPA045134 (B).
Antibody #2 product nr: HPA045134
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows cytoplasmic positivity in macrophages.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in Hofbauer cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no cytoplasmic positivity in neurons as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MRC1 antibody HPA004114.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MRC1 antibody HPA004114.
Sample type: HUMAN