Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91569 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-KLK3
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLS
EPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEP
EEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFML
CAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSE
PCA- Epitope
- Binds to an epitope located within the peptide sequence NRFLRPGDDS as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL9422
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human prostate tissue.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human prostate and placenta tissues using AMAb91569 antibody. Corresponding KLK3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in non-germinal and germinal center cells as expected.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate cancer shows strong cytoplasmic positivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.