Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91257 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91257, RRID:AB_2665868
- Product name
- Anti-BRAF
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
PIPQEEASLAETALTSGSSPSAPASDSIGPQILTS
PSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPN
VHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPP
ASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRM
KTLGRRDSS- Epitope
- Binds to an epitope located within the peptide sequence SAPASDSIGPQILTS as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL4003
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line MOLT-4.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil and cytoplasmic staining in some neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong cytoplasmic immunoreactivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows moderate cytoplasmic positivity in tumor cells.