Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90727 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90727, RRID:AB_2665645
- Product name
- Anti-MEF2C
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPL
AHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSG
AGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPP
PMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN- Epitope
- Binds to an epitope located within the peptide sequence SNPVSSLGNPNLLPL as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0368
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in WM115 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MEF2C antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: MEF2C Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419349)
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of RH-30 cells using the Anti-MEF2C monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in neuronal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows moderate nuclear positivity in muscle fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong nuclear immunoreactivity in a subset of lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong nuclear immunoreactivity in a subset of lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows absense of staining (negative control).