Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005805-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005805-B01P, RRID:AB_1579417
- Product name
- PTS purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human PTS protein.
- Antigen sequence
MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEE
NLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMV
MNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVS
TTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIV
VYKGE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PTS expression in transfected 293T cell line (H00005805-T01) by PTS MaxPab polyclonal antibody.Lane 1: PTS transfected lysate(15.95 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to PTS on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol