ARP42888_T100

antibody from Aviva Systems Biology

Targeting: OCLN PPP1R115

Antibody data

Submit

Validation data

Product number: ARP42888_T100 - Provider product page
Provider: Aviva Systems Biology
Proper citation: Aviva Systems Biology Cat#ARP42888_T100, RRID:AB_1294580
Product name: Anti-SPATA12
Antibody type: Polyclonal
Antigen: Synthetic peptide
Description: This is a rabbit polyclonal antibody against SPATA12. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment; please inquire (info@avivasysbio.com).
Reactivity: Human
Host: Rabbit
Antigen sequence: Antigen corresponding to the follow ing peptide sequence: MSSSALTCGSTLE KSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPH CA
Isotype: IgG
Vial size: 50ug
Concentration: 1 mg/ml
Handling: Add 50 μl of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage; store at -20°C. Avoid repeat freeze-thaw cycles.

OCLN protein structure - ARP42888_T100 shown in red.