Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001401 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001401, RRID:AB_1080132
- Product name
- Anti-SOD1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHV
HEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVG
DLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTL
VVHEKADDLGKGGNEESTKTGNAGSRLACG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Marinesco-Sjögren syndrome protein SIL1 regulates motor neuron subtype-selective ER stress in ALS
NQO2 is a reactive oxygen species generating off-target for acetaminophen.
Filézac de L'Etang A, Maharjan N, Cordeiro Braña M, Ruegsegger C, Rehmann R, Goswami A, Roos A, Troost D, Schneider B, Weis J, Saxena S
Nature Neuroscience 2015 January;18(2):227-238
Nature Neuroscience 2015 January;18(2):227-238
NQO2 is a reactive oxygen species generating off-target for acetaminophen.
Miettinen TP, Björklund M
Molecular pharmaceutics 2014 Dec 1;11(12):4395-404
Molecular pharmaceutics 2014 Dec 1;11(12):4395-404
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-SOD1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human liver and pancreas tissues using HPA001401 antibody. Corresponding SOD1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.
- Sample type
- HUMAN