Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000874-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000874-M05, RRID:AB_1672308
- Product name
- CBR3 monoclonal antibody (M05), clone 1G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CBR3.
- Antigen sequence
KNEVHEREGWPNSPYGVSKLGVTVLSRILARRLDE
KRKADRILVNACCPGPVKTDMDGKDSIRTVEEGAE
TPVYLALLPPDATEPQGQLVHDKVVQNW- Isotype
- IgG
- Antibody clone number
- 1G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CBR3 monoclonal antibody (M05), clone 1G8. Western Blot analysis of CBR3 expression in HepG2(Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CBR3 expression in transfected 293T cell line by CBR3 monoclonal antibody (M05), clone 1G8.Lane 1: CBR3 transfected lysate (Predicted MW: 30.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CBR3 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CBR3 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
