HPA016739

antibody from Atlas Antibodies

Targeting: MAPRE2 EB1, EB2, RP1

Western blot (Enhanced validation)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

HPA016739

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA016739, RRID:AB_1853570

Product name

Anti-MAPRE2

Antibody type

Polyclonal

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

KFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFN
LPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAK


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Western blot analysis in human cell lines A-549 and A-431 using Anti-MAPRE2 antibody. Corresponding MAPRE2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Western blot analysis in human cell line A-549 and human cell line A-431.

Orthogonal method

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human cerebral cortex and testis tissues using HPA016739 antibody. Corresponding MAPRE2 RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Independent antibody validation

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-MAPRE2 antibody HPA016739 (A) shows similar protein distribution across tissues to independent antibody HPA016738 (B).

Antibody #2 product nr

HPA016738

Antibody provider

Atlas Antibodies

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows strong positivity in islet cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows high expression.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human testis shows low expression as expected.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows high expression.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in peripheral nerve / ganglion.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.

Sample type

HUMAN