Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000835 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000835, RRID:AB_1079499
- Product name
- Anti-NPC2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSY
SVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEP
DGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLV
VEWQLQDDKNQSLFCWEIPVQIVSH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Pulmonary abnormalities in animal models due to Niemann-Pick type C1 (NPC1) or C2 (NPC2) disease.
Lung cancer signatures in plasma based on proteome profiling of mouse tumor models.
Use of narrow-range peptide IEF to improve detection of lung adenocarcinoma markers in plasma and pleural effusion
Roszell BR, Tao JQ, Yu KJ, Gao L, Huang S, Ning Y, Feinstein SI, Vite CH, Bates SR
PloS one 2013;8(7):e67084
PloS one 2013;8(7):e67084
Lung cancer signatures in plasma based on proteome profiling of mouse tumor models.
Taguchi A, Politi K, Pitteri SJ, Lockwood WW, Faça VM, Kelly-Spratt K, Wong CH, Zhang Q, Chin A, Park KS, Goodman G, Gazdar AF, Sage J, Dinulescu DM, Kucherlapati R, Depinho RA, Kemp CJ, Varmus HE, Hanash SM
Cancer cell 2011 Sep 13;20(3):289-99
Cancer cell 2011 Sep 13;20(3):289-99
Use of narrow-range peptide IEF to improve detection of lung adenocarcinoma markers in plasma and pleural effusion
Pernemalm M, De Petris L, Eriksson H, Brandén E, Koyi H, Kanter L, Lewensohn R, Lehtiö J
PROTEOMICS 2009 July;9(13):3414-3424
PROTEOMICS 2009 July;9(13):3414-3424
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines U2OS and HeLa using Anti-NPC2 antibody. Corresponding NPC2 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human epididymis and skeletal muscle tissues using HPA000835 antibody. Corresponding NPC2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human epididymis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human epididymis shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong granular cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows weak granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN