HPA001616

antibody from Atlas Antibodies

Targeting: KNG1 BDK, BK, KNG

Antibody data

Submit

Validation data

Product number: HPA001616 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001616, RRID:AB_1079216
Product name: Anti-KNG1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSF KYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTA TVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLG CVHPISTQSPDLEPILRHGIQYFNNN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

KNG1 protein structure - HPA001616 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, prostate and testis using Anti-KNG1 antibody HPA001616 (A) shows similar protein distribution across tissues to independent antibody HPA001645 (B).
Antibody #2 product nr: HPA001645
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows cytoplasmic positivity with a granular pattern and extra-cellular positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-KNG1 antibody HPA001616.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-KNG1 antibody HPA001616.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate using Anti-KNG1 antibody HPA001616.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-KNG1 antibody HPA001616.
Sample type: HUMAN