H00079192-A01

antibody from Abnova Corporation

Targeting: IRX1 IRX-5

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

H00079192-A01

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00079192-A01, RRID:AB_462925

Product name

IRX1 polyclonal antibody (A01)

Antibody type

Polyclonal

Description

Mouse polyclonal antibody raised against a partial recombinant IRX1.

Antigen sequence

NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQP
VRDNSLAPQEGTPRILAALPS


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene.

Zougman A, Mann M, Wisniewski JR
Nucleic acids research 2011 Sep 1;39(16):7103-13

---

Helicobacter pylori induces promoter hypermethylation and downregulates gene expression of IRX1 transcription factor on human gastric mucosa.

Guo XB, Guo L, Zhi QM, Ji J, Jiang JL, Zhang RJ, Zhang JN, Zhang J, Chen XH, Cai Q, Li JF, Yan M, Gu QL, Liu BY, Zhu ZG, Yu YY
Journal of gastroenterology and hepatology 2011 Nov;26(11):1685-90

---

Homeobox gene IRX1 is a tumor suppressor gene in gastric carcinoma.

Guo X, Liu W, Pan Y, Ni P, Ji J, Guo L, Zhang J, Wu J, Jiang J, Chen X, Cai Q, Li J, Zhang J, Gu Q, Liu B, Zhu Z, Yu Y
Oncogene 2010 Jul 8;29(27):3908-20

Western blot

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

IRX1 polyclonal antibody (A01), Lot # 051025JC01 Western Blot analysis of IRX1 expression in Y-79 ( Cat # L042V1 ).